PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02160.1.g00110.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 327aa    MW: 35721.7 Da    PI: 8.4814
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02160.1.g00110.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.21.4e-161462148
                                  TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                                  +g+W++eEd +l+++++ +G+g +W + +++ g++R++k+c++rw++yl
  Zmw_sc02160.1.g00110.1.sm.mk 14 KGPWSPEEDRKLKEYIHNHGTGgNWIALPHKAGLKRCGKSCRLRWLNYL 62
                                  79*********************************************97 PP

2Myb_DNA-binding38.92e-1269111246
                                   SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
               Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                   g ++++Ed ++  +++  G++ W+ Ia+ ++ gRt++++k++w++
  Zmw_sc02160.1.g00110.1.sm.mk  69 GDFSEDEDRIICSLFTAIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                                   689******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.135962IPR017930Myb domain
SuperFamilySSF466891.47E-2611109IPR009057Homeodomain-like
SMARTSM007171.9E-121364IPR001005SANT/Myb domain
PfamPF002497.5E-161462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.7E-241569IPR009057Homeodomain-like
CDDcd001671.02E-91662No hitNo description
PROSITE profilePS5129421.72363117IPR017930Myb domain
SMARTSM007175.5E-1167115IPR001005SANT/Myb domain
PfamPF002491.8E-1069111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-2270117IPR009057Homeodomain-like
CDDcd001679.97E-871113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MGRAPCCDKA SVKKGPWSPE EDRKLKEYIH NHGTGGNWIA LPHKAGLKRC GKSCRLRWLN  60
YLRPNIKHGD FSEDEDRIIC SLFTAIGSRW SIIAAQLPGR TDNDIKNYWN TKLKKKLMLA  120
HGLQPPTTTN TNSHHHRSKK QQQLFFSAQA EAPSSATQPP GEPLSLQYLS TPFHNFSYHY  180
GSRCYDSNTP TSHHSAGTGG SLLMLGGSND EQHMISSPCF PNYGSSHGHD SAAVAASLAM  240
ESFVFQDDHH KALQVLLASG TASLDHQNGT NTSCGYEETA KPLLVNVTAG GGGSNWVSNS  300
FFCSYSEEKS SSSPNAAGVS RQGSFMY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-26141177108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004956269.17e-99PREDICTED: myb-related protein Hv1-like
TrEMBLK3ZVB38e-99K3ZVB3_SETIT; Uncharacterized protein
STRINGSi030544m2e-98(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP13538412